PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G173200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 728aa    MW: 82315 Da    PI: 6.9281
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G173200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS332.76.9e-1023537191374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cA+avs ++++la+a+L+ +++++s +gd +qRla++++  L+arla+++ +ly++l ++  +    +  l++    ++++P+ 
  Sevir.9G173200.1.p 353 LRTLLIHCAQAVSVNNHTLASAILNIIRKNCSISGDDTQRLASCLADCLEARLAGTGCQLYQKLVTKCRN---AVGILKV----FQLCPFQ 436
                         6789*********************************************************999988887...4444444....589**** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                            +   N++Il+  +g+++vHiiDf+i +G+QWp+L+++LasR++gpp++RiTg++ p++g    ++  +tg+ La++A+ + vpfe++ 
  Sevir.9G173200.1.p 437 MAPNYFSNKTILDVSKGKSKVHIIDFGICYGFQWPSLFEQLASRENGPPKVRITGIELPQPGfrPDQMNTNTGHLLAEYASMFSVPFEYHG 527
                         *************************************************************9*88888999******************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +++++e++++e+++++++++l+Vn+ +++++l de+vs++s+r++vL++++ ++Pkv+v+   + +++++ Fl+rf e +++ysalfd l
  Sevir.9G173200.1.p 528 -ITSKWETIRIEDFHIEEDDVLIVNCLFRMKNLGDETVSINSARNRVLNTIRMMKPKVFVHGVVNGSYSTPFFLTRFKELMYHYSALFDIL 617
                         .799*************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ++ +pr++e r+ +Er +    i nv+aceg++r+er e+++kW++r  +aG++++pl+ +++k  + ++ ++++d y v e++++l+lgW
  Sevir.9G173200.1.p 618 DKIVPRDNESRMIIERDIYLCTILNVIACEGSDRIERPESFKKWKSRNLKAGLEQLPLNPDIVKVTRDIVGQYHKD-YVVGEDDQWLLLGW 707
                         **************************************************************************77.************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r L ++S W+
  Sevir.9G173200.1.p 708 KGRILKAISTWK 719
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575124No hitNo description
PROSITE profilePS5098557.838327700IPR005202Transcription factor GRAS
PfamPF035142.4E-99353719IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MEFNGKSSSN FEDFPSSISS TSGCYALSQK SVDPADESND LELFLHPPSF MNYYPPVSST  60
FNDHGHITLN NSYPSKIYGP QCCEVSSNAA LDWYGTSVAG SSKSSWINSD ITLNYINKLL  120
MQEDSDGRVK LHHGENALRD VEEPFYKLLG QNSSAYPLLP LRSCDYPNNL NGCIDKSWQS  180
CSSCSVAIDS SNNHSNHNLQ AFEAPWSLSD IVKETNHLTQ GTNNMEHGLN IDGLSIAEKR  240
SRDNKSLQVN VANTSMHASF EVQCQNYPRT EGFYLLEGRS SKQLAISFSR PTRDEMFDRV  300
LLFSEHKPTD EGIVLREMMT SKSTRNSQND QERTSARRRT RGKKQEKKEV VDLRTLLIHC  360
AQAVSVNNHT LASAILNIIR KNCSISGDDT QRLASCLADC LEARLAGTGC QLYQKLVTKC  420
RNAVGILKVF QLCPFQMAPN YFSNKTILDV SKGKSKVHII DFGICYGFQW PSLFEQLASR  480
ENGPPKVRIT GIELPQPGFR PDQMNTNTGH LLAEYASMFS VPFEYHGITS KWETIRIEDF  540
HIEEDDVLIV NCLFRMKNLG DETVSINSAR NRVLNTIRMM KPKVFVHGVV NGSYSTPFFL  600
TRFKELMYHY SALFDILDKI VPRDNESRMI IERDIYLCTI LNVIACEGSD RIERPESFKK  660
WKSRNLKAGL EQLPLNPDIV KVTRDIVGQY HKDYVVGEDD QWLLLGWKGR ILKAISTWKP  720
NESYDGD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-413577198375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008665058.10.0PREDICTED: scarecrow-like protein 34 isoform X2
TrEMBLK4AMS50.0K4AMS5_SETIT; Uncharacterized protein
STRINGSi040221m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-145GRAS family protein